Loading...
Catalog No: ARP58509_P050
Price: $0.00
SKU
ARP58509_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PDGFB Antibody - N-terminal region (ARP58509_P050)

Datasheets/ManualsPrintable datasheet for anti-PDGFB (ARP58509_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PDGFB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD
Concentration0.5 mg/ml
Blocking PeptideFor anti-PDGFB (ARP58509_P050) antibody is Catalog # AAP58509 (Previous Catalog # AAPP34718)
Sample Type Confirmation

There is BioGPS gene expression data showing that PDGFB is expressed in HEK293T

SubunitB
ReferenceChadjichristos,C.E., (2008) Circ. Res. 102 (6), 653-660
Gene SymbolPDGFB
Gene Full NamePlatelet-derived growth factor beta polypeptide
Alias SymbolsSIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2
NCBI Gene Id5155
Protein NamePlatelet-derived growth factor subunit B
Description of TargetPDGFB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor.The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two splice variants have been identified for this gene.
Uniprot IDP01127
Protein Accession #NP_002599
Nucleotide Accession #NM_002608
Protein Size (# AA)241
Molecular Weight27kDa
Protein InteractionsCOL6A1; COL5A1; COL4A1; COL3A1; COL2A1; COL1A2; COL1A1; LYVE1; NRP1; ADIPOQ; MDFI; PDAP1; ART1; PDGFB; HRAS; THBS1; PDGFRA; PDGFRB; HSPG2; LRP1; A2M; SPARC;
  1. What is the species homology for "PDGFB Antibody - N-terminal region (ARP58509_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Sheep".

  2. How long will it take to receive "PDGFB Antibody - N-terminal region (ARP58509_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PDGFB Antibody - N-terminal region (ARP58509_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PDGFB Antibody - N-terminal region (ARP58509_P050)"?

    This target may also be called "SIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2" in publications.

  5. What is the shipping cost for "PDGFB Antibody - N-terminal region (ARP58509_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PDGFB Antibody - N-terminal region (ARP58509_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PDGFB Antibody - N-terminal region (ARP58509_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PDGFB Antibody - N-terminal region (ARP58509_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PDGFB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PDGFB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PDGFB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PDGFB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PDGFB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PDGFB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PDGFB Antibody - N-terminal region (ARP58509_P050)
Your Rating
We found other products you might like!