Search Antibody, Protein, and ELISA Kit Solutions

PDE9A Antibody (ARP45760_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45760_P050-FITC Conjugated

ARP45760_P050-HRP Conjugated

ARP45760_P050-Biotin Conjugated

Gene Symbol:
PDE9A
Official Gene Full Name:
Phosphodiesterase 9A
NCBI Gene Id:
5152
Protein Name:
High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
Swissprot Id:
O76083-13
Protein Accession #:
NP_001001581
Nucleotide Accession #:
NM_001001581
Alias Symbols:
HSPDE9A2
Replacement Item:
This antibody may replace item sc-166375 from Santa Cruz Biotechnology.
Description of Target:
PDE9A catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides.The protein encoded by this gene catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The encoded protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple transcript variants encoding several different isoforms have been found for this gene.
Protein Size (# AA):
526
Molecular Weight:
61kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PDE9A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PDE9A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PDE9A
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 92%
Complete computational species homology data:
Anti-PDE9A (ARP45760_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NAA38; UTP23; KRTAP9-2; TRPV6; GORASP2; TRIM32; BAG3; LAGE3; SULT1E1; PDE9A; LMO2; CRY2; CLK1; C9orf106; NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP4-2; PHYHIPL;
Blocking Peptide:
For anti-PDE9A (ARP45760_P050) antibody is Catalog # AAP45760 (Previous Catalog # AAPP26712)
Datasheets/Manuals:
Printable datasheet for anti-PDE9A (ARP45760_P050) antibody
Additional Information:
IHC Information: Jurkat cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%.
Target Reference:
Huai,Q., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (26), 9624-9629

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...