PDE4B Antibody - middle region (ARP56256_P050)

Catalog No: ARP56256_P050

WB Suggested Anti-PDE4B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE4B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PDE4B (ARP56256_P050) antibody is Catalog # AAP56256 (Previous Catalog # AAPP38223)
• Reference: Fatemi,S.H., Schizophr. Res. 101 (1-3), 36-49 (2008)

Target Info

• Gene Symbol: PDE4B
• Gene Full Name: Phosphodiesterase 4B, cAMP-specific
• Alias Symbols: DPDE4, PDEIVB
• NCBI Gene Id: 5142
• Protein Name: Phosphodiesterase 4B, cAMP-specific (Phosphodiesterase E4 dunce homolog, Drosophila) EMBL CAI21750.1
• Description of Target: The specific function of this protein remains unknown.This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. The cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. This gene encodes a protein that specifically hydrolyzes cAMP. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Uniprot ID: Q5TEK5
• Protein Accession #: NP_001032416
• Nucleotide Accession #: NM_001037339
• Protein Size (# AA): 564
• Molecular Weight: 64kDa
• Protein Interactions: MAGEA11; RCBTB2; APOA1; ALB; PAFAH1B1; UBC; DISC1; PRKACA;