PDCD8 Antibody - C-terminal region (ARP40199_P050)

Catalog No: ARP40199_P050

WB Suggested Anti-PDCD8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateAIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat

Host: Rabbit
Target Name: AIFM1
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml

Host: Mouse
Target Name: AIFM1
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml

Rabbit Anti-AIFM1 Antibody
Catalog Number: ARP40199_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic, nucleus
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Rabbit Anti-AIFM1 Antibody
Catalog Number: ARP40199_P050
Formalin Fixed Paraffin Embedded Tissue: Human Kidney Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

AIFM1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP40199_P050 with 1:200 dilution. Western blot was performed using ARP40199_P050 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: AIFM1 IP with ARP40199_P050 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate.

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC, IP
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PDCD8
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AIFM1 (ARP40199_P050) antibody is Catalog # AAP40199 (Previous Catalog # AAPP22045)
• Sample Type Confirmation:

  AIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Delettre,C., (er) J. Biol. Chem. (2006) In press

Target Info

• Gene Symbol: AIFM1
• Gene Full Name: Apoptosis-inducing factor, mitochondrion-associated, 1
• Alias Symbols: AIF, AUNX1, CMT2D, CMTX4, COWCK, DFNX5, NADMR, NAMSD, PDCD8, COXPD6, SEMDHL
• NCBI Gene Id: 9131
• Protein Name: Apoptosis-inducing factor 1, mitochondrial
• Description of Target: AIFM1 (PDCD8) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, AIFM1 induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9.This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Three alternative transcripts encoding different isoforms have been identified for this gene.
• Uniprot ID: O95831-2
• Protein Accession #: NP_665812
• Nucleotide Accession #: NM_145813
• Protein Size (# AA): 326
• Molecular Weight: 36kDa
• Protein Interactions: ISG15; STAU1; BAG6; UBC; NEDD8; MDM2; ASB12; RNF2; BMI1; SUZ12; PARK2; BAG3; ADRB2; HDAC11; OXSR1; ILK; PAN2; NOS2; MLH1; CFTR; ESR1; TST; FSCN1; CPOX; SHC1; FBXO6; TSC22D4; CAND1; COPS5; CUL1; CUL2; CUL3; CUL5; TONSL; BLNK; PIDD1; XIAP; AMFR; Tubb4b; Tub