Search Antibody, Protein, and ELISA Kit Solutions

PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75320_P050 Unconjugated

ARP75320_P050-HRP Conjugated

ARP75320_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
programmed cell death 6 interacting protein
NCBI Gene Id:
Protein Name:
programmed cell death 6-interacting protein
Swissprot Id:
Protein Accession #:
Alias Symbols:
Description of Target:
This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PDCD6IP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PDCD6IP.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDC6I
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: QMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PDCD6IP (ARP75320_P050-FITC) antibody is Catalog # AAP75320
Printable datasheet for anti-PDCD6IP (ARP75320_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...