SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP75320_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP75320_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-PDCD6IP (ARP75320_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human PDC6I
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: QMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQS
Concentration0.5 mg/ml
Blocking PeptideFor anti-PDCD6IP (ARP75320_P050-FITC) antibody is Catalog # AAP75320
ReferenceN/A
Gene SymbolPDCD6IP
Gene Full Nameprogrammed cell death 6 interacting protein
Alias SymbolsAIP1, ALIX, HP95, DRIP4
NCBI Gene Id10015
Protein Nameprogrammed cell death 6-interacting protein
Description of TargetThis gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15.
Uniprot IDQ8WUM4
Protein Accession #NP_037506
Protein Size (# AA)868
Molecular Weight95kDa
Protein InteractionsUBI4; CEP55; UBC; SUMO2; nef; EZH2; IPO9; UBA6; MCTS1; AHCYL1; EZR; UBA1; MAPK1; CHMP4B; gag; UBD; BAG3; RNF11; KEAP1; VCAM1; SH3GL1; CHMP4C; TNIP2; ITGA4; CXCR1; GRB2; HOXA1; PEF1; VPS4B; ABCC1; GPI; PDCD6; F2R; CUL3; ALG2; PTK2B; TUBB; SIRT7; SH3KBP1; C
  1. What is the species homology for "PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)"?

    This target may also be called "AIP1, ALIX, HP95, DRIP4" in publications.

  5. What is the shipping cost for "PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "95kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PDCD6IP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PDCD6IP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PDCD6IP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PDCD6IP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PDCD6IP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PDCD6IP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PDCD6IP Antibody - C-terminal region : FITC (ARP75320_P050-FITC)
Your Rating
We found other products you might like!