Search Antibody, Protein, and ELISA Kit Solutions

PCYT1B Antibody - C-terminal region (ARP82696_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PCYT1B
Official Gene Full Name:
phosphate cytidylyltransferase 1, choline, beta
NCBI Gene Id:
9468
Protein Name:
choline-phosphate cytidylyltransferase B
Swissprot Id:
Q9Y5K3
Protein Accession #:
NP_001156736.1
Nucleotide Accession #:
NM_001163264.1
Alias Symbols:
CTB, CCTB
Description of Target:
The protein encoded by this gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
369
Molecular Weight:
42 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PCYT1B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PCYT1B.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of Human PCYT1B
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PCYT1B (ARP82696_P050) antibody is Catalog # AAP82696
Datasheets/Manuals:
Printable datasheet for anti-PCYT1B (ARP82696_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...