PCOLCE Antibody - C-terminal region (ARP74117_P050)

Catalog No: ARP74117_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: PCOC1
Sample Type: 786-0 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PCOC1
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: SSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PCOLCE (ARP74117_P050) antibody is Catalog # AAP74117

Target Info

• Gene Symbol: PCOLCE
• Gene Full Name: procollagen C-endopeptidase enhancer
• Alias Symbols: PCPE, PCPE1, PCPE-1
• NCBI Gene Id: 5118
• Protein Name: procollagen C-endopeptidase enhancer 1
• Description of Target: Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity.
• Uniprot ID: Q15113
• Protein Accession #: NP_002584
• Protein Size (# AA): 449
• Molecular Weight: 49kDa
• Protein Interactions: ECT2; PLG; COL3A1; COL2A1;