Search Antibody, Protein, and ELISA Kit Solutions

PCNA Antibody - N-terminal region : FITC (ARP72403_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72403_P050 Unconjugated

ARP72403_P050-HRP Conjugated

ARP72403_P050-Biotin Conjugated

Gene Symbol:
PCNA
NCBI Gene Id:
5111
Swissprot Id:
P12004
Protein Accession #:
NP_872590
Alias Symbols:
PCNA,
Replacement Item:
This antibody may replace item sc-170834 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
Protein Size (# AA):
261
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PCNA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PCNA.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PCNA
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: AMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
GADD45A; CDKN1A; HUWE1; POLH; PCNA; MSH3; FUS; UBC; TMEM218; CHFR; DTL; POLE; POLD1; MCM7; MCM4; LIG1; MSH6; FEN1; FBXO18; ZRANB3; CHTF18; DNMT1; RAD18; SIVA1; KIAA0101; TDG; SUMO2; SUMO3; RPA1; RFC5; RFC4; RFC3; RFC2; RFC1; MDM2; TRIM25; USP18; ISG15; MA
Blocking Peptide:
For anti-PCNA (ARP72403_P050-FITC) antibody is Catalog # AAP72403
Datasheets/Manuals:
Printable datasheet for anti-PCNA (ARP72403_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...