Search Antibody, Protein, and ELISA Kit Solutions

PCNA Antibody - N-terminal region (ARP72403_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72403_P050-FITC Conjugated

ARP72403_P050-HRP Conjugated

ARP72403_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
PCNA
NCBI Gene Id:
5111
Swissprot Id:
P12004
Protein Accession #:
NP_872590
Alias Symbols:
PCNA,
Replacement Item:
This antibody may replace item sc-170834 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
Protein Size (# AA):
261
Molecular Weight:
28kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PCNA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PCNA.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PCNA
Peptide Sequence:
Synthetic peptide located within the following region: AMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEM
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GADD45A; CDKN1A; HUWE1; POLH; PCNA; MSH3; FUS; UBC; TMEM218; CHFR; DTL; POLE; POLD1; MCM7; MCM4; LIG1; MSH6; FEN1; FBXO18; ZRANB3; CHTF18; DNMT1; RAD18; SIVA1; KIAA0101; TDG; SUMO2; SUMO3; RPA1; RFC5; RFC4; RFC3; RFC2; RFC1; MDM2; TRIM25; USP18; ISG15; MA
Blocking Peptide:
For anti-PCNA (ARP72403_P050) antibody is Catalog # AAP72403
Datasheets/Manuals:
Printable datasheet for anti-PCNA (ARP72403_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...