PCNA Antibody - C-terminal region : HRP (AVARP03018_T100-HRP)

Catalog No: AVARP03018_T100-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PCNA
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 91%
• Peptide Sequence: Synthetic peptide located within the following region: LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PCNA (AVARP03018_T100-HRP) antibody is Catalog # AAP30202 (Previous Catalog # AAPS09007)
• Sample Type Confirmation:

  PCNA is supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Senga,T., (2006) J. Biol. Chem. 281 (10), 6246-6252
• Publications:

  Liu, Z. et al. Human umbilical cord mesenchymal stromal cells rescue mice from acetaminophen-induced acute liver failure. Cytotherapy 16, 1207-19 (2014). WB, Bovine, Dog, Human, Mouse, Rat, Zebrafish 25108650

Target Info

• Gene Symbol: PCNA
• Gene Full Name: Proliferating cell nuclear antigen
• Alias Symbols: ATLD2
• NCBI Gene Id: 5111
• Protein Name: Proliferating cell nuclear antigen
• Description of Target: PCNA is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
• Uniprot ID: P12004
• Protein Accession #: NP_002583
• Nucleotide Accession #: NM_002592
• Protein Size (# AA): 261
• Molecular Weight: 29kDa
• Protein Interactions: GADD45A; CDKN1A; HUWE1; POLH; PCNA; MSH3; FUS; UBC; TMEM218; CHFR; DTL; POLE; POLD1; MCM7; MCM4; LIG1; MSH6; FEN1; FBXO18; ZRANB3; CHTF18; DNMT1; RAD18; SIVA1; KIAA0101; TDG; SUMO2; SUMO3; RPA1; RFC5; RFC4; RFC3; RFC2; RFC1; MDM2; TRIM25; USP18; ISG15; MA