Search Antibody, Protein, and ELISA Kit Solutions

PCGF4 Antibody - C-terminal region (ARP34213_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34213_P050-FITC Conjugated

ARP34213_P050-HRP Conjugated

ARP34213_P050-Biotin Conjugated

Gene Symbol:
BMI1
Official Gene Full Name:
BMI1 polycomb ring finger oncogene
NCBI Gene Id:
648
Protein Name:
Polycomb complex protein BMI-1
Swissprot Id:
P35226
Protein Accession #:
NP_005171
Nucleotide Accession #:
NM_005180
Alias Symbols:
PCGF4, RNF51, FLVI2/BMI1
Replacement Item:
This antibody may replace item sc-10745 from Santa Cruz Biotechnology.
Description of Target:
PCGF4 regulates telomerase expression in MECs and plays a role in the development of human breast cancer.
Protein Size (# AA):
326
Molecular Weight:
37kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PCGF4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PCGF4.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PCGF4
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%; Yeast: 83%
Complete computational species homology data:
Anti-PCGF4 (ARP34213_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RNF2; RING1; NDEL1; PHC2; UBC; TP53; HIST4H4; LENG8; PAXBP1; SFXN1; TIMM50; ZC3HAV1L; NME1; NHP2L1; NFX1; NDUFA4; NCL; NCBP1; MAGOH; CAPRIN1; KTN1; ILF3; ILF2; IK; HSPA1A; HIST1H2BB; HIST1H2BD; GTF3C1; GATA2; FUS; EWSR1; FBL; ERH; EP300; ELAVL1; ELAVL2; D
Blocking Peptide:
For anti-BMI1 (ARP34213_P050) antibody is Catalog # AAP34213 (Previous Catalog # AAPP05528)
Datasheets/Manuals:
Printable datasheet for anti-BMI1 (ARP34213_P050) antibody
Sample Type Confirmation:

BMI1 is supported by BioGPS gene expression data to be expressed in A172

Target Reference:
Guney,I., et al., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (10), 3645-3650

Product Reviews

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

110/04/2017 17:30
  • Overall Experience:
  • Quality:
Product Review: PCGF4 antibody - C-terminal region (ARP34213_P050) in human myeloma cell using Western Blot
20 ug of protein lysate from human Mutliple Myeloma cell lines were loaded

Primary Antibody Dilutions were 1:500 for both antibodies in 5% tween TBS milk solution. The membranes were incubated overnight at 4 C.

Secondary Antibody dilutions were 1:4000 in 5% tween TBS milk solution. The membranes were incuabted for 1 hour at room temprature.
Protocol:
Exponentially growing human MM cell lines were collected and lysed on ice in RIPA extraction buffer with freshly added protease inhibitors.
Protein concentration was measured by Bradford method.
20 ug of protein were loaded in each well.
Protein separation was done using 4-12% tris-gels from invitrogen.
Membranes were blocked with 5% milk Tween TBS solution for 1 hour at room temprature.
Primary antibody dilutions were 1:500 for both antibodies in 5% tween TBS milk solution. The membranes were incubated overnight at 4 C.
Horse-Radish Peroxidase cpuopled secondary antibody dilutions were 1:4000 in 5% tween TBS milk solution. The membranes were incuabted for 1 hour at room temprature. Western blot were developed using the ECL-system from amersham, GE-healthcare.
I think the BMI-1 antibody ARP34213 is giving the expected band for BMI-1 protein based on the size (around 45 kDa). This is in agreement with the results that I have obtained using the BMI-1 antibody from Santa cruz (sc-390443).
Human myeloma cell

Submitted by Mohammad Alzrigat, Rudbeck Laboratory, Uppsala University
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...