Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PCGF3 antibody - middle region (ARP34416_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP34416_P050-FITC Conjugated

ARP34416_P050-HRP Conjugated

ARP34416_P050-Biotin Conjugated

Gene Symbol:
PCGF3
NCBI Gene Id:
10336
Official Gene Full Name:
Polycomb group ring finger 3
Protein Name:
Polycomb group RING finger protein 3
Swissprot Id:
Q3KNV8
Protein Accession #:
NP_006306
Nucleotide Accession #:
NM_006315
Alias Symbols:
RNF3, DONG1, RNF3A
Replacement Item:
This antibody may replace item sc-104578 from Santa Cruz Biotechnology.
Description of Target:
PCGF3 encodes a protein that contains a C3HC4 type RING finger, which is a motif known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined.
Protein Size (# AA):
242
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PCGF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PCGF3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PCGF3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 86%
Complete computational species homology data:
Anti-PCGF3 (ARP34416_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEED
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PHC2; BCOR; UBE2C; RNF2; CSNK2A2; BCORL1; CBX8; CBX7; CBX6; HSP90AA1; TRIM9; DZIP3; RING1; BMI1; KDM2B; FBRS; FBRSL1; AUTS2; RYBP; MGA; PCGF3; YAF2; CBX4; USP7; CSNK2B; CSNK2A1; UBC;
Blocking Peptide:
For anti-PCGF3 (ARP34416_P050) antibody is Catalog # AAP34416 (Previous Catalog # AAPY00318)
Datasheets/Manuals:
Printable datasheet for anti-PCGF3 (ARP34416_P050) antibody
Sample Type Confirmation:

PCGF3 is strongly supported by BioGPS gene expression data to be expressed in Raji

Target Reference:
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45

Tell us what you think about this item!

Write A Review
    Please, wait...