Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP49389_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49389_P050-FITC Conjugated

ARP49389_P050-HRP Conjugated

ARP49389_P050-Biotin Conjugated

PCDHGC4 Antibody - N-terminal region (ARP49389_P050)

Catalog#: ARP49389_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-106954 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PCDHGC4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Horse: 100%; Human: 100%; Mouse: 100%; Pig: 91%; Rabbit: 79%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-PCDHGC4 (ARP49389_P050)
Peptide Sequence Synthetic peptide located within the following region: VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PCDHGC4 (ARP49389_P050) antibody is Catalog # AAP49389 (Previous Catalog # AAPY02658)
Datasheets/Manuals Printable datasheet for anti-PCDHGC4 (ARP49389_P050) antibody
Target Reference Wu,Q., (2001) Genome Res. 11 (3), 389-404
Gene Symbol PCDHGC4
Official Gene Full Name Protocadherin gamma subfamily C, 4
Alias Symbols MGC119489, PCDH-GAMMA-C4
NCBI Gene Id 56098
Protein Name Protocadherin gamma-C4
Description of Target PCDHGC4 is a single-pass type I membrane protein. It contains 6 cadherin domains.PCDHGC4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
Swissprot Id Q9Y5F7
Protein Accession # NP_061751
Nucleotide Accession # NM_018928
Protein Size (# AA) 938
Molecular Weight 98kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PCDHGC4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PCDHGC4.
  1. What is the species homology for "PCDHGC4 Antibody - N-terminal region (ARP49389_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "PCDHGC4 Antibody - N-terminal region (ARP49389_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PCDHGC4 Antibody - N-terminal region (ARP49389_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PCDHGC4 Antibody - N-terminal region (ARP49389_P050)"?

    This target may also be called "MGC119489, PCDH-GAMMA-C4" in publications.

  5. What is the shipping cost for "PCDHGC4 Antibody - N-terminal region (ARP49389_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PCDHGC4 Antibody - N-terminal region (ARP49389_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PCDHGC4 Antibody - N-terminal region (ARP49389_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "98kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PCDHGC4 Antibody - N-terminal region (ARP49389_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PCDHGC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PCDHGC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PCDHGC4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PCDHGC4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PCDHGC4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PCDHGC4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PCDHGC4 Antibody - N-terminal region (ARP49389_P050)
Your Rating