Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PCDHGC4 antibody - N-terminal region (ARP49389_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP49389_P050-FITC Conjugated

ARP49389_P050-HRP Conjugated

ARP49389_P050-Biotin Conjugated

Gene Symbol:
PCDHGC4
NCBI Gene Id:
56098
Official Gene Full Name:
Protocadherin gamma subfamily C, 4
Protein Name:
Protocadherin gamma-C4
Swissprot Id:
Q9Y5F7
Protein Accession #:
NP_061751
Nucleotide Accession #:
NM_018928
Alias Symbols:
MGC119489, PCDH-GAMMA-C4
Replacement Item:
This antibody may replace item sc-106954 from Santa Cruz Biotechnology.
Description of Target:
PCDHGC4 is a single-pass type I membrane protein. It contains 6 cadherin domains.PCDHGC4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
Protein Size (# AA):
938
Molecular Weight:
98kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PCDHGC4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PCDHGC4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PCDHGC4
Species Reactivity:
Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Horse: 100%; Human: 100%; Mouse: 100%; Pig: 91%; Rabbit: 79%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PCDHGC4 (ARP49389_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PCDHGC4 (ARP49389_P050) antibody is Catalog # AAP49389 (Previous Catalog # AAPY02658)
Datasheets/Manuals:
Printable datasheet for anti-PCDHGC4 (ARP49389_P050) antibody
Target Reference:
Wu,Q., (2001) Genome Res. 11 (3), 389-404

Tell us what you think about this item!

Write A Review
    Please, wait...