PCDHB16 Antibody - middle region (ARP49598_P050)

Catalog No: ARP49598_P050

WB Suggested Anti-PCDHB16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCDHB16
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: IPENSPLGSLVATVSARDLDGGANGKISYTLFQPSEDISKTLEVNPMTGE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PCDHB16 (ARP49598_P050) antibody is Catalog # AAP49598 (Previous Catalog # AAPP44245)

Target Info

• Gene Symbol: PCDHB16
• Gene Full Name: Protocadherin beta 16
• Alias Symbols: ME1, PCDH3X, PCDHB8a, PCDH-BETA16
• NCBI Gene Id: 57717
• Protein Name: Protocadherin beta-16
• Description of Target: This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections.
• Uniprot ID: Q9NRJ7
• Protein Accession #: NP_066008
• Nucleotide Accession #: NM_020957
• Protein Size (# AA): 776
• Molecular Weight: 82kDa