PCDHA4 Antibody - C-terminal region (ARP46960_P050)

Catalog No: ARP46960_P050

WB Suggested Anti-PCDHA4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PCDHA4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PCDHA4 (ARP46960_P050) antibody is Catalog # AAP46960 (Previous Catalog # AAPP27758)
• Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Target Info

• Gene Symbol: PCDHA4
• Gene Full Name: Protocadherin alpha 4
• Alias Symbols: CNR1, CNRN1, CRNR1, PCDH-ALPHA4
• NCBI Gene Id: 56144
• Protein Name: Protocadherin alpha-4
• Description of Target: The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.
• Uniprot ID: Q9UN74
• Protein Accession #: NP_061730
• Nucleotide Accession #: NM_018907
• Protein Size (# AA): 947
• Molecular Weight: 99kDa
• Protein Interactions: SGTA; LRIF1; CCDC90B; RBM48; IGSF21; SETDB1; C14orf1; UNC119; GDF9; RELN; TLE1; TP53; GAPDH; EEF1A1; APLP1;