PCDH8 Antibody - middle region (ARP45338_P050)

Catalog No: ARP45338_P050

WB Suggested Anti-PCDH8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCDH8
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PCDH8 (ARP45338_P050) antibody is Catalog # AAP45338 (Previous Catalog # AAPP26314)
• Reference: Lim,J., (2006) Cell 125 (4), 801-814

Target Info

• Gene Symbol: PCDH8
• Gene Full Name: Protocadherin 8
• Alias Symbols: PAPC, ARCADLIN
• NCBI Gene Id: 5100
• Protein Name: Protocadherin-8
• Description of Target: This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. PCDH8 is an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region. Alternative splicing yields isoforms with unique cytoplasmic tails.
• Uniprot ID: Q5TAN1
• Protein Accession #: NP_116567
• Nucleotide Accession #: NM_032949
• Protein Size (# AA): 973
• Molecular Weight: 101kDa
• Protein Interactions: UBQLN4; BTRC; PCDH8;