Catalog No: ARP56116_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP56116_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PCCB Antibody - middle region : HRP (ARP56116_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-PCCB (ARP56116_P050-HRP) antibody
Product Info
ReferenceDesviat,L.R., (2006) J. Hum. Genet. 51 (11), 992-997
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PCCB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS
Concentration0.5 mg/ml
Blocking PeptideFor anti-PCCB (ARP56116_P050-HRP) antibody is Catalog # AAP56116 (Previous Catalog # AAPP37737)
Gene SymbolPCCB
Gene Full NamePropionyl CoA carboxylase, beta polypeptide
Alias SymbolsDKFZp451E113
NCBI Gene Id5096
Protein NamePropionyl-CoA carboxylase beta chain, mitochondrial
Description of TargetPCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).
Uniprot IDP05166
Protein Accession #NP_000523
Nucleotide Accession #NM_000532
Protein Size (# AA)539
Molecular Weight58kDa
Protein InteractionsHUWE1; PARK2; IFIT1; INPPL1; EPS15; UBE2N; UBC; EBNA-LP; ICT1; PCCB; PCCA;
  1. What is the species homology for "PCCB Antibody - middle region : HRP (ARP56116_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "PCCB Antibody - middle region : HRP (ARP56116_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PCCB Antibody - middle region : HRP (ARP56116_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PCCB Antibody - middle region : HRP (ARP56116_P050-HRP)"?

    This target may also be called "DKFZp451E113" in publications.

  5. What is the shipping cost for "PCCB Antibody - middle region : HRP (ARP56116_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PCCB Antibody - middle region : HRP (ARP56116_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PCCB Antibody - middle region : HRP (ARP56116_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PCCB Antibody - middle region : HRP (ARP56116_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PCCB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PCCB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PCCB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PCCB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PCCB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PCCB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PCCB Antibody - middle region : HRP (ARP56116_P050-HRP)
Your Rating
We found other products you might like!