Search Antibody, Protein, and ELISA Kit Solutions

PC Antibody - middle region (ARP97247_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PC
Official Gene Full Name:
pyruvate carboxylase
NCBI Gene Id:
25104
Protein Name:
Pyruvate carboxylase, mitochondrial
Swissprot Id:
P52873
Protein Accession #:
NP_036876
Nucleotide Accession #:
NM_012744.2
Alias Symbols:
Pcx
Description of Target:
biotin-containing enzyme that catalyses the carboxylation of pyruvate to form oxaloacetate.
Protein Size (# AA):
1178
Molecular Weight:
129 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PC.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of rat PC
Predicted Species Reactivity:
Rat
Tested Species Reactivity:
Rat
Peptide Sequence:
Synthetic peptide located within the following region: EAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PC (ARP97247_P050) antibody is Catalog # AAP97247
Datasheets/Manuals:
Printable datasheet for anti-PC (ARP97247_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...