PBURS Recombinant Protein (Fruit fly) (OPCA01353)

Catalog No: OPCA01353

Product Info

• Predicted Species Reactivity: Drosophila melanogaster
• Product Format: Liquid or Lyophilized powder
• Additional Information: Tag information : His tag
  
• Reconstitution and Storage: -20°C or -80°C
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR
• Protein Sequence: LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 21-141 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Drosophila molting neurohormone bursicon is a heterodimer and the natural agonist of the orphan receptor DLGR2.Mendive F.M., Van Loy T., Claeysen S., Poels J., Williamson M., Hauser F., Grimmelikhuijzen C.J.P., Vassart G., Vanden Broeck J.J.M.FEBS Lett. 579:2171-2176(2005)
• Gene Symbol: Pburs
• Gene Full Name: Partner of Bursicon
• Alias Symbols: A;Bur beta;Burs beta;burs-beta;Bursbeta;bursicon;bursicon beta;bursicon beta subunit;bursicon beta-subunit;Bursicon subunit beta;CG15284;CG15284-PA;Dmel\CG15284;Dmel_CG15284;lethal group A;pads-b;partner of burs;partner of bursicon;partner-of-bursicon;pburs;Pburs-PA;pu;pup;pupal.
• NCBI Gene Id: 34845
• Protein Name: Partner of bursicon
• Description of Target: Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.
• Uniprot ID: Q9VJS7
• Protein Size (# AA): Recombinant
• Molecular Weight: 15.8 kDa