Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Pax7 antibody - middle region (ARP30947_P050)

100 ul
In Stock

Conjugation Options

ARP30947_P050-FITC Conjugated

ARP30947_P050-HRP Conjugated

ARP30947_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Paired box 7
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-130019 from Santa Cruz Biotechnology.
Description of Target:
The function of Pax7 remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Pax7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Pax7.
The immunogen is a synthetic peptide directed towards the middle region of human Pax7
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-Pax7 (ARP30947_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Pax7 (ARP30947_P050) antibody is Catalog # AAP30947 (Previous Catalog # AAPP24013)
Printable datasheet for anti-Pax7 (ARP30947_P050) antibody

Ezin, A. M., Sechrist, J. W., Zah, A., Bronner, M. & Fraser, S. E. Early regulative ability of the neuroepithelium to form cardiac neural crest. Dev. Biol. 349, 238-49 (2011). IF, WB, Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 21047505

Van Ry, P. M., Minogue, P., Hodges, B. L. & Burkin, D. J. Laminin-111 improves muscle repair in a mouse model of merosin-deficient congenital muscular dystrophy. Hum. Mol. Genet. (2013). doi:10.1093/hmg/ddt428 IF, WB, Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 24009313

Tell us what you think about this item!

Write A Review
    Please, wait...