Size:100 ul
$319.00
In Stock
SKU
ARP30947_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30947_P050-FITC Conjugated

ARP30947_P050-HRP Conjugated

ARP30947_P050-Biotin Conjugated

Pax7 Antibody - middle region (ARP30947_P050)

Catalog#: ARP30947_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Rat, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IF, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130019 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human Pax7
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-Pax7 (ARP30947_P050)
Peptide Sequence Synthetic peptide located within the following region: SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Pax7 (ARP30947_P050) antibody is Catalog # AAP30947 (Previous Catalog # AAPP24013)
Datasheets/Manuals Printable datasheet for anti-Pax7 (ARP30947_P050) antibody
Other Applications Image 1 Data Immunofluorescence --
Sample Type: Overexpression of Pax7 in C2C12 cells
Dilution: 1:100
Other Applications Image 2 Data Immunofluorescence --
Sample Type: SC derived myoblasts
Dilution: 1:100
Publications

Ezin, A. M., Sechrist, J. W., Zah, A., Bronner, M. & Fraser, S. E. Early regulative ability of the neuroepithelium to form cardiac neural crest. Dev. Biol. 349, 238-49 (2011). IF, WB, Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 21047505

Van Ry, P. M., Minogue, P., Hodges, B. L. & Burkin, D. J. Laminin-111 improves muscle repair in a mouse model of merosin-deficient congenital muscular dystrophy. Hum. Mol. Genet. 23, 383-96 (2014). IF, WB, Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 24009313

Gene Symbol Pax7
Official Gene Full Name Paired box 7
Alias Symbols RGD1564360
NCBI Gene Id 500574
Description of Target The function of Pax7 remains unknown.
Protein Accession # NP_001178913
Nucleotide Accession # NM_001191984
Protein Size (# AA) 503
Molecular Weight 55kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Pax7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Pax7.
  1. What is the species homology for "Pax7 Antibody - middle region (ARP30947_P050)"?

    The tested species reactivity for this item is "Rat, Mouse". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "Pax7 Antibody - middle region (ARP30947_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Pax7 Antibody - middle region (ARP30947_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Pax7 Antibody - middle region (ARP30947_P050)"?

    This target may also be called "RGD1564360" in publications.

  5. What is the shipping cost for "Pax7 Antibody - middle region (ARP30947_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Pax7 Antibody - middle region (ARP30947_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Pax7 Antibody - middle region (ARP30947_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Pax7 Antibody - middle region (ARP30947_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PAX7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PAX7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PAX7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PAX7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PAX7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PAX7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Pax7 Antibody - middle region (ARP30947_P050)
Your Rating
We found other products you might like!