Search Antibody, Protein, and ELISA Kit Solutions

PAX4 Antibody - N-terminal region (ARP32737_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32737_P050-FITC Conjugated

ARP32737_P050-HRP Conjugated

ARP32737_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
PAX4
Official Gene Full Name:
Paired box 4
NCBI Gene Id:
5078
Protein Name:
Paired box protein Pax-4
Swissprot Id:
O43316-4
Protein Accession #:
NP_006184
Nucleotide Accession #:
NM_006193
Alias Symbols:
MGC129960, KPD, MODY9
Replacement Item:
This antibody may replace item sc-27832 from Santa Cruz Biotechnology.
Description of Target:
PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells. This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box 4 gene is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing beta cells. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
343
Molecular Weight:
37kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAX4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAX4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PAX4
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 93%
Complete computational species homology data:
Anti-PAX4 (ARP32737_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GMCL1;
Blocking Peptide:
For anti-PAX4 (ARP32737_P050) antibody is Catalog # AAP32737 (Previous Catalog # AAPP03751)
Datasheets/Manuals:
Printable datasheet for anti-PAX4 (ARP32737_P050) antibody
Target Reference:
Brun,T., (2008) Hum. Mol. Genet. 17 (4), 478-489

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...