Catalog No: ARP32064_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP32064_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PAX4 Antibody - middle region : HRP (ARP32064_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-PAX4 (ARP32064_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PAX4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA
Concentration0.5 mg/ml
Blocking PeptideFor anti-PAX4 (ARP32064_P050-HRP) antibody is Catalog # AAP32064 (Previous Catalog # AAPP02966)
Sample Type Confirmation

PAX4 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

PAX4 is supported by BioGPS gene expression data to be expressed in COLO205

Specificity100% homologous to all 3 isoforms (38, 30, 37kDa).
Publications

Zhang, L. et al. KIT is an independent prognostic marker for pancreatic endocrine tumors: a finding derived from analysis of islet cell differentiation markers. Am. J. Surg. Pathol. 33, 1562-9 (2009). WB, IHC, ELISA, Human, Mouse, Rabbit, Dog, Bovine, Pig, Horse, Guinea pig, Rat 19574886

Gene SymbolPAX4
Gene Full NamePaired box 4
Alias SymbolsKPD, MODY9
NCBI Gene Id5078
Protein NamePaired box gene 4 EMBL EAL24318.1
Description of TargetPAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells.
Uniprot IDO43316
Protein Accession #NP_006184
Nucleotide Accession #NM_006193
Protein Size (# AA)343
Molecular Weight37kDa
Protein InteractionsGMCL1;
  1. What is the species homology for "PAX4 Antibody - middle region : HRP (ARP32064_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "PAX4 Antibody - middle region : HRP (ARP32064_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PAX4 Antibody - middle region : HRP (ARP32064_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PAX4 Antibody - middle region : HRP (ARP32064_P050-HRP)"?

    This target may also be called "KPD, MODY9" in publications.

  5. What is the shipping cost for "PAX4 Antibody - middle region : HRP (ARP32064_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PAX4 Antibody - middle region : HRP (ARP32064_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PAX4 Antibody - middle region : HRP (ARP32064_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PAX4 Antibody - middle region : HRP (ARP32064_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PAX4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PAX4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PAX4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PAX4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PAX4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PAX4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PAX4 Antibody - middle region : HRP (ARP32064_P050-HRP)
Your Rating
We found other products you might like!