Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP32064_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32064_P050-FITC Conjugated

ARP32064_P050-HRP Conjugated

ARP32064_P050-Biotin Conjugated

PAX4 Antibody - middle region (ARP32064_P050)

Catalog#: ARP32064_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-27832 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PAX4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Complete computational species homology data Anti-PAX4 (ARP32064_P050)
Peptide Sequence Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PAX4 (ARP32064_P050) antibody is Catalog # AAP32064 (Previous Catalog # AAPP02966)
Datasheets/Manuals Printable datasheet for anti-PAX4 (ARP32064_P050) antibody
Sample Type Confirmation

PAX4 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

PAX4 is supported by BioGPS gene expression data to be expressed in COLO205

Specificity 100% homologous to all 3 isoforms (38, 30, 37kDa).
Publications

Zhang, L. et al. KIT is an independent prognostic marker for pancreatic endocrine tumors: a finding derived from analysis of islet cell differentiation markers. Am. J. Surg. Pathol. 33, 1562-9 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19574886

Gene Symbol PAX4
Official Gene Full Name Paired box 4
Alias Symbols KPD, MGC129960, MODY9
NCBI Gene Id 5078
Protein Name Paired box gene 4 EMBL EAL24318.1
Description of Target PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells.
Swissprot Id O43316
Protein Accession # NP_006184
Nucleotide Accession # NM_006193
Protein Size (# AA) 343
Molecular Weight 37kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PAX4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PAX4.
Protein Interactions GMCL1;
Write Your Own Review
You're reviewing:PAX4 Antibody - middle region (ARP32064_P050)
Your Rating