Search Antibody, Protein, and ELISA Kit Solutions

PAX4 antibody - middle region (ARP32064_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32064_P050-FITC Conjugated

ARP32064_P050-HRP Conjugated

ARP32064_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Paired box 4
Protein Name:
Paired box gene 4 EMBL EAL24318.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
KPD, MGC129960, MODY9
Replacement Item:
This antibody may replace item sc-27832 from Santa Cruz Biotechnology.
Description of Target:
PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAX4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAX4.
The immunogen is a synthetic peptide directed towards the middle region of human PAX4
Tested Species Reactivity:
Human, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Complete computational species homology data:
Anti-PAX4 (ARP32064_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PAX4 (ARP32064_P050) antibody is Catalog # AAP32064 (Previous Catalog # AAPP02966)
Printable datasheet for anti-PAX4 (ARP32064_P050) antibody
Sample Type Confirmation:

PAX4 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

PAX4 is supported by BioGPS gene expression data to be expressed in COLO205

100% homologous to all 3 isoforms (38, 30, 37kDa).

Zhang, L. et al. KIT is an independent prognostic marker for pancreatic endocrine tumors: a finding derived from analysis of islet cell differentiation markers. Am. J. Surg. Pathol. 33, 1562-9 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19574886

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...