Search Antibody, Protein, and ELISA Kit Solutions

PAX2 antibody - middle region (P100859_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

P100859_T100-FITC Conjugated

P100859_T100-HRP Conjugated

P100859_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Paired box 2
Protein Name:
Paired box protein Pax-2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Replacement Item:
This antibody may replace item sc-130387 from Santa Cruz Biotechnology.
Description of Target:
PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAX2.
The immunogen is a synthetic peptide directed towards the middle region of human PAX2
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PAX2 (P100859_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PAX2 (P100859_T100) antibody is Catalog # AAP31220 (Previous Catalog # AAPP01965)
Printable datasheet for anti-PAX2 (P100859_T100) antibody
Target Reference:
Muratovska, A., et al., (2003) Oncogene 22 (39), 7989-7997.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...