Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

PAX2 Antibody - middle region (P100859_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100859_P050-FITC Conjugated

P100859_P050-HRP Conjugated

P100859_P050-Biotin Conjugated

Gene Symbol:
PAX2
Official Gene Full Name:
Paired box 2
NCBI Gene Id:
5076
Protein Name:
Paired box protein Pax-2
Swissprot Id:
Q02962
Protein Accession #:
NP_000269
Nucleotide Accession #:
NM_000278
Alias Symbols:
RP11-179B2.1
Replacement Item:
This antibody may replace item sc-130387 from Santa Cruz Biotechnology.
Description of Target:
PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Protein Size (# AA):
417
Molecular Weight:
45kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAX2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PAX2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PAX2 (P100859_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BBS7; BBS4; BBS2; BBS1; RB1; BRCA1; SFRP2; PAXIP1; WT1; MAPK8IP1; MAPK8; ID2;
Blocking Peptide:
For anti-PAX2 (P100859_P050) antibody is Catalog # AAP31220
Datasheets/Manuals:
Printable datasheet for anti-PAX2 (P100859_P050) antibody
Target Reference:
Bacchetta,J., (2008) Kidney Int. 73 (8), 977-978

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...