Search Antibody, Protein, and ELISA Kit Solutions

PAX2 Antibody - middle region : FITC (P100859_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100859_P050 Unconjugated

P100859_P050-HRP Conjugated

P100859_P050-Biotin Conjugated

Gene Symbol:
PAX2
Official Gene Full Name:
Paired box 2
NCBI Gene Id:
5076
Protein Name:
Paired box protein Pax-2
Swissprot Id:
Q02962
Protein Accession #:
NP_000269
Nucleotide Accession #:
NM_000278
Alias Symbols:
RP11-179B2.1
Replacement Item:
This antibody may replace item sc-130387 from Santa Cruz Biotechnology.
Description of Target:
PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Protein Size (# AA):
417
Molecular Weight:
45kDa
Host:
Rabbit
Clonality:
Polyclonal
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAX2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PAX2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PAX2 (P100859_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
BBS7; BBS4; BBS2; BBS1; RB1; BRCA1; SFRP2; PAXIP1; WT1; MAPK8IP1; MAPK8; ID2;
Blocking Peptide:
For anti-PAX2 (P100859_P050-FITC) antibody is Catalog # AAP31220
Datasheets/Manuals:
Printable datasheet for anti-PAX2 (P100859_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Bacchetta,J., (2008) Kidney Int. 73 (8), 977-978

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...