SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58040_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP58040_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PAX1 Antibody - middle region : FITC (ARP58040_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-PAX1 (ARP58040_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PAX1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: SISRILRNKIGSLAQPGPYEASKQPPSQPTLPYNHIYQYPYPSPVSPTGA
Concentration0.5 mg/ml
Blocking PeptideFor anti-PAX1 (ARP58040_P050-FITC) antibody is Catalog # AAP58040 (Previous Catalog # AAPP32463)
Sample Type Confirmation

PAX1 is supported by BioGPS gene expression data to be expressed in 721_B

ReferenceVatanavicharn,N., (2007) Am. J. Med. Genet. A 143 (19), 2292-2302
Gene SymbolPAX1
Gene Full NamePaired box 1
Alias SymbolsOFC2, HUP48
NCBI Gene Id5075
Protein NamePaired box protein Pax-1
Description of TargetThe PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates.The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates (McGaughran et al., 2003 [PubMed 12774041]). See PAX7 (MIM 167410) for a discussion of paired box domain genes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP15863
Protein Accession #NP_006183
Nucleotide Accession #NM_006192
Protein Size (# AA)440
Molecular Weight46kDa
Protein InteractionsMEOX2; MEOX1;
  1. What is the species homology for "PAX1 Antibody - middle region : FITC (ARP58040_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit".

  2. How long will it take to receive "PAX1 Antibody - middle region : FITC (ARP58040_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PAX1 Antibody - middle region : FITC (ARP58040_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PAX1 Antibody - middle region : FITC (ARP58040_P050-FITC)"?

    This target may also be called "OFC2, HUP48" in publications.

  5. What is the shipping cost for "PAX1 Antibody - middle region : FITC (ARP58040_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PAX1 Antibody - middle region : FITC (ARP58040_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PAX1 Antibody - middle region : FITC (ARP58040_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PAX1 Antibody - middle region : FITC (ARP58040_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PAX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PAX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PAX1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PAX1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PAX1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PAX1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PAX1 Antibody - middle region : FITC (ARP58040_P050-FITC)
Your Rating
We found other products you might like!