Catalog No: OPCA03440
Price: $0.00
SKU
OPCA03440
Availability: Domestic: within 4-6 weeks delivery | International: 4-6 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Parvalbumin beta Recombinant Protein (Atlantic cod) (OPCA03440)

In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.
Datasheets/ManualsPrintable datasheet for Parvalbumin beta Recombinant Protein (Gadus morhua) (OPCA03440)
Product Info
Predicted Species ReactivityAtlantic cod
Product FormatLyophilized 20mM Tris-HCl, 0.5M NaCl, 6% Trehalose (pH 8.0)
HostGadus morhua
Reconstitution and StorageWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
PurificationAffinity purified using IMAC.
PurityGreater than 90% as determined by SDS-PAGE.
Protein SequenceFull Length of Mature Protein: AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
SourceE. Coli
Enhanced ValidationEnhanced Validation
Protein Range2-109 aa
TagN-terminal 6xHis-SUMO-tagged
ReferenceThe major allergen (parvalbumin) of codfish is encoded by at least two isotypic genes: cDNA cloning, expression and antibody binding of the recombinant allergens.Van Do T., Hordvik I., Endresen C., Elsayed S.Mol. Immunol. 39:595-602(2003)
Alias SymbolsAllergen: Gad m 1
Swissprot IdQ90YK9
Protein Size (# AA)2-109 aa
Molecular Weight27.4 kDa
Write Your Own Review
You're reviewing:Parvalbumin beta Recombinant Protein (Atlantic cod) (OPCA03440)
Your Rating