Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

PAPSS2 Antibody - C-terminal region : FITC (ARP74113_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74113_P050 Unconjugated

ARP74113_P050-HRP Conjugated

ARP74113_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PAPSS2
Official Gene Full Name:
3'-phosphoadenosine 5'-phosphosulfate synthase 2
NCBI Gene Id:
9060
Protein Name:
bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Swissprot Id:
O95340
Protein Accession #:
NP_004661
Alias Symbols:
SK2, BCYM4, ATPSK2
Description of Target:
Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.
Protein Size (# AA):
614
Molecular Weight:
67kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAPSS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAPSS2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAPS2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
RIC8A; ARIH2; GTF3C4; TXNRD1; TUBB2A; HNRNPA2B1; APEX1; UBD; UBC; APP; Papss1; VHL;
Blocking Peptide:
For anti-PAPSS2 (ARP74113_P050-FITC) antibody is Catalog # AAP74113
Datasheets/Manuals:
Printable datasheet for anti-PAPSS2 (ARP74113_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...