Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP48642_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48642_P050-FITC Conjugated

ARP48642_P050-HRP Conjugated

ARP48642_P050-Biotin Conjugated

PAPSS2 Antibody - C-terminal region (ARP48642_P050)

Catalog#: ARP48642_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100801 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PAPSS2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-PAPSS2 (ARP48642_P050)
Peptide Sequence Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PAPSS2 (ARP48642_P050) antibody is Catalog # AAP48642 (Previous Catalog # AAPY01614)
Datasheets/Manuals Printable datasheet for anti-PAPSS2 (ARP48642_P050) antibody
Sample Type Confirmation

PAPSS2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

There is BioGPS gene expression data showing that PAPSS2 is expressed in 721_B

Target Reference Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Gene Symbol PAPSS2
Official Gene Full Name 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Alias Symbols ATPSK2, SK2
NCBI Gene Id 9060
Protein Name Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Description of Target Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. PAPSS2 is one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.
Swissprot Id O95340-2
Protein Accession # NP_001015880
Nucleotide Accession # NM_001015880
Protein Size (# AA) 619
Molecular Weight 70kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PAPSS2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PAPSS2.
Protein Interactions RIC8A; ARIH2; GTF3C4; TXNRD1; TUBB2A; HNRNPA2B1; APEX1; UBD; UBC; APP; Papss1; VHL;
Write Your Own Review
You're reviewing:PAPSS2 Antibody - C-terminal region (ARP48642_P050)
Your Rating