Search Antibody, Protein, and ELISA Kit Solutions

PAPSS2 Antibody - C-terminal region (ARP48642_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP48642_P050-FITC Conjugated

ARP48642_P050-HRP Conjugated

ARP48642_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-100801 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PAPSS2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-PAPSS2 (ARP48642_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PAPSS2 (ARP48642_P050) antibody is Catalog # AAP48642 (Previous Catalog # AAPY01614)
Datasheets/Manuals:
Printable datasheet for anti-PAPSS2 (ARP48642_P050) antibody
Sample Type Confirmation:

PAPSS2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

There is BioGPS gene expression data showing that PAPSS2 is expressed in 721_B

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Gene Symbol:
PAPSS2
Official Gene Full Name:
3'-phosphoadenosine 5'-phosphosulfate synthase 2
Alias Symbols:
ATPSK2, SK2
NCBI Gene Id:
9060
Protein Name:
Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Description of Target:
Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. PAPSS2 is one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.
Swissprot Id:
O95340-2
Protein Accession #:
NP_001015880
Nucleotide Accession #:
NM_001015880
Protein Size (# AA):
619
Molecular Weight:
70kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAPSS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAPSS2.
Protein Interactions:
RIC8A; ARIH2; GTF3C4; TXNRD1; TUBB2A; HNRNPA2B1; APEX1; UBD; UBC; APP; Papss1; VHL;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...