Search Antibody, Protein, and ELISA Kit Solutions

PAPSS2 Antibody - C-terminal region (ARP48642_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48642_P050-FITC Conjugated

ARP48642_P050-HRP Conjugated

ARP48642_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
3'-phosphoadenosine 5'-phosphosulfate synthase 2
NCBI Gene Id:
Protein Name:
Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-100801 from Santa Cruz Biotechnology.
Description of Target:
Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. PAPSS2 is one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAPSS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAPSS2.
The immunogen is a synthetic peptide directed towards the C terminal region of human PAPSS2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-PAPSS2 (ARP48642_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PAPSS2 (ARP48642_P050) antibody is Catalog # AAP48642 (Previous Catalog # AAPY01614)
Printable datasheet for anti-PAPSS2 (ARP48642_P050) antibody
Sample Type Confirmation:

PAPSS2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

There is BioGPS gene expression data showing that PAPSS2 is expressed in 721_B

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...