SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP42778_T100
Price: $0.00
SKU
ARP42778_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PANX2 (ARP42778_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PANX2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA
Concentration1.0 mg/ml
Blocking PeptideFor anti-PANX2 (ARP42778_T100) antibody is Catalog # AAP42778 (Previous Catalog # AAPS10104)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceBaranova,A., (2004) Genomics 83 (4), 706-716
Publications

Human stem cells express pannexins. BMC Res Notes. 11, 54 (2018). 29357945

Lai, C. P. K., Bechberger, J. F. & Naus, C. C. Pannexin2 as a novel growth regulator in C6 glioma cells. Oncogene 28, 4402-8 (2009). 19749789

Manipulation of Panx1 Activity Increases the Engraftment of Transplanted Lacrimal Gland Epithelial Progenitor Cells. Invest Ophthalmol Vis Sci. 58, 5654-5665 (2017). 29098296

Mylvaganam, S. et al. Hippocampal seizures alter the expression of the pannexin and connexin transcriptome. J. Neurochem. 112, 92-102 (2010). 19840216

Pannexin 2 is expressed in murine skin and promotes UVB-induced apoptosis of keratinocytes. Mol Biol Cell. mbcE21080387 (2022). 34985913

Swayne, L. A., Sorbara, C. D. & Bennett, S. A. L. Pannexin 2 is expressed by postnatal hippocampal neural progenitors and modulates neuronal commitment. J. Biol. Chem. 285, 24977-86 (2010). 20529862

Wang, X.-H., Streeter, M., Liu, Y.-P. & Zhao, H.-B. Identification and characterization of pannexin expression in the mammalian cochlea. J. Comp. Neurol. 512, 336-46 (2009). 19009624

Wicki-Stordeur, L. E., Boyce, A. K. J. & Swayne, L. A. Analysis of a pannexin 2-pannexin 1 chimeric protein supports divergent roles for pannexin C-termini in cellular localization. Cell Commun. Adhes. 20, 73-9 (2013). 23659289

Description
Gene SymbolPANX2
Gene Full NamePannexin 2
Alias SymbolsPX2, hPANX2
NCBI Gene Id56666
Protein NamePannexin-2
Description of TargetPANX2 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.
Uniprot IDQ96RD6
Protein Accession #NP_443071
Nucleotide Accession #NM_052839
Protein Size (# AA)633
Molecular Weight74 kDa
  1. What is the species homology for "PANX2 Antibody - N-terminal region (ARP42778_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "PANX2 Antibody - N-terminal region (ARP42778_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PANX2 Antibody - N-terminal region (ARP42778_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PANX2 Antibody - N-terminal region (ARP42778_T100)"?

    This target may also be called "PX2, hPANX2" in publications.

  5. What is the shipping cost for "PANX2 Antibody - N-terminal region (ARP42778_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PANX2 Antibody - N-terminal region (ARP42778_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PANX2 Antibody - N-terminal region (ARP42778_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "74 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PANX2 Antibody - N-terminal region (ARP42778_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PANX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PANX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PANX2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PANX2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PANX2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PANX2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PANX2 Antibody - N-terminal region (ARP42778_T100)
Your Rating