Catalog No: ARP57156_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP57156_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PANK4 Antibody - middle region : FITC (ARP57156_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-PANK4 (ARP57156_P050-FITC) antibody
Product Info
Reference0
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PANK4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD
Concentration0.5 mg/ml
Blocking PeptideFor anti-PANK4 (ARP57156_P050-FITC) antibody is Catalog # AAP57156 (Previous Catalog # AAPP40808)
Gene SymbolPANK4
Gene Full NamePantothenate kinase 4
Alias SymbolsDKFZp547M242, FLJ10782
NCBI Gene Id55229
Protein NamePantothenate kinase 4
Description of TargetThis gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynt
Uniprot IDQ9NVE7
Protein Accession #NP_060686
Nucleotide Accession #NM_018216
Protein Size (# AA)773
Molecular Weight86kDa
Protein InteractionsEGFR; TP53RK; EFTUD1; OSGEP; NSUN2; TERF2IP; UFM1; EEF2K; KIAA1279; ACTR2; SAE1; UBE3C; TPD52L2; RANGAP1; BAG1; CDK20; UBC; C18orf8; PTPN6; PEA15;
  1. What is the species homology for "PANK4 Antibody - middle region : FITC (ARP57156_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish".

  2. How long will it take to receive "PANK4 Antibody - middle region : FITC (ARP57156_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PANK4 Antibody - middle region : FITC (ARP57156_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PANK4 Antibody - middle region : FITC (ARP57156_P050-FITC)"?

    This target may also be called "DKFZp547M242, FLJ10782" in publications.

  5. What is the shipping cost for "PANK4 Antibody - middle region : FITC (ARP57156_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PANK4 Antibody - middle region : FITC (ARP57156_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PANK4 Antibody - middle region : FITC (ARP57156_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "86kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PANK4 Antibody - middle region : FITC (ARP57156_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PANK4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PANK4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PANK4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PANK4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PANK4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PANK4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PANK4 Antibody - middle region : FITC (ARP57156_P050-FITC)
Your Rating
We found other products you might like!