PAM16 Antibody - C-terminal region (ARP65133_P050)

Catalog No: ARP65133_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-PAM16 Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole CellPAM16 is supported by BioGPS gene expression data to be expressed in HepG2

Host: Rabbit
Target Name: PAM16
Sample Type: Jurkat
Antibody Dilution: 1.0ug/mlPAM16 is supported by BioGPS gene expression data to be expressed in Jurkat

Host: Rabbit
Target Name: PAM16
Sample Type: Hela
Antibody Dilution: 1.0ug/mlPAM16 is supported by BioGPS gene expression data to be expressed in HeLa

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Human: 100%; Mouse: 86%; Pig: 79%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: NYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PAM16 (ARP65133_P050) antibody is Catalog # AAP65133
• Sample Type Confirmation:

  PAM16 is supported by BioGPS gene expression data to be expressed in HeLa, HepG2, Jurkat

• Subunit: TIM16

Target Info

• Gene Symbol: PAM16
• Gene Full Name: Presequence translocase-associated motor 16 homolog (S. cerevisiae)
• Alias Symbols: TIM16, MAGMAS, SMDMDM, TIMM16, CGI-136
• NCBI Gene Id: 51025
• Protein Name: Mitochondrial import inner membrane translocase subunit TIM16
• Description of Target: PAM16 regulates ATP-dependent protein translocation into the mitochondrial matrix and inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
• Uniprot ID: Q9Y3D7
• Protein Accession #: NP_057153
• Nucleotide Accession #: NM_016069
• Protein Size (# AA): 125
• Molecular Weight: 14kDa
• Protein Interactions: ARL6IP1; UBC; EIF3C; BLOC1S2; MRFAP1; CEP70; PGRMC1; FEZ1; GPM6A; DNMT3B; TIM23; PAM18; DNAJC19; TIMM17A;