Search Antibody, Protein, and ELISA Kit Solutions

PAK6 Antibody - N-terminal region : FITC (ARP75699_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75699_P050 Unconjugated

ARP75699_P050-HRP Conjugated

ARP75699_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-25975 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of a family of p21-stimulated serine/threonine protein kinases, which contain an amino-terminal Cdc42/Rac interactive binding (CRIB) domain and a carboxyl-terminal kinase domain. These kinases function in a number of cellular processes, including cytoskeleton rearrangement, apoptosis, and the mitogen-activated protein (MAP) kinase signaling pathway. The protein encoded by this gene interacts with androgen receptor (AR) and translocates to the nucleus, where it is involved in transcriptional regulation. Changes in expression of this gene have been linked to prostate cancer. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAK6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAK6.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PAK6
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: RVQLQPMKTVVRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PAK6 (ARP75699_P050-FITC) antibody is Catalog # AAP75699
Printable datasheet for anti-PAK6 (ARP75699_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...