PAK1 Antibody - middle region (ARP86951_P050)

Catalog No: ARP86951_P050

Host: Rabbit
Target Name: PAK1
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAK1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: NTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PAK1 (ARP86951_P050) antibody is Catalog # AAP86951

Target Info

• Gene Symbol: PAK1
• Gene Full Name: p21 protein (Cdc42/Rac)-activated kinase 1
• Alias Symbols: IDDMSSD, p65-PAK, PAKalpha, alpha-PAK
• NCBI Gene Id: 5058
• Protein Name: serine/threonine-protein kinase PAK 1
• Description of Target: This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q13153
• Protein Accession #: NP_001122092.1
• Nucleotide Accession #: NM_001128620.1
• Protein Size (# AA): 545
• Molecular Weight: 61 kDa