Search Antibody, Protein, and ELISA Kit Solutions

PAICS antibody - N-terminal region (ARP46049_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46049_P050-FITC Conjugated

ARP46049_P050-HRP Conjugated

ARP46049_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PAICS
NCBI Gene Id:
10606
Official Gene Full Name:
Phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Protein Name:
Multifunctional protein ADE2
Swissprot Id:
P22234
Protein Accession #:
NP_001072992
Nucleotide Accession #:
NM_001079524
Alias Symbols:
ADE2, ADE2H1, AIRC, DKFZp781N1372, MGC1343, MGC5024, PAIS
Description of Target:
PAICS is a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. This gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
425
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAICS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAICS.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PAICS
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-PAICS (ARP46049_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
L3MBTL2; PAICS; HUWE1; UBC; FUS; WWOX; QRICH1; SWAP70; FARSB; SUPT5H; SET; PRKCSH; FXR2; NUDT18; SMARCD1; PRKAG1; FN1; NIF3L1; TP53BP1; UNK; GINS4; TMEM177; RPAP1; SSSCA1; TACC3; STUB1; PUM1; ZPR1; UBE2B; TTC1; NDUFV1; GART; UBD; CUL3; CDK2; TERF1; SIRT7;
Blocking Peptide:
For anti-PAICS (ARP46049_P050) antibody is Catalog # AAP46049 (Previous Catalog # AAPP26890)
Datasheets/Manuals:
Printable datasheet for anti-PAICS (ARP46049_P050) antibody
Target Reference:
Beausoleil,S.A., (2006) Nat. Biotechnol. 24 (10), 1285-1292

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...