Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP42335_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42335_P050-FITC Conjugated

ARP42335_P050-HRP Conjugated

ARP42335_P050-Biotin Conjugated

PAGE4 Antibody - N-terminal region (ARP42335_P050)

Catalog#: ARP42335_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human PAGE4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Complete computational species homology dataAnti-PAGE4 (ARP42335_P050)
Peptide SequenceSynthetic peptide located within the following region: DGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDC
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-PAGE4 (ARP42335_P050) antibody is Catalog # AAP42335
Datasheets/ManualsPrintable datasheet for anti-PAGE4 (ARP42335_P050) antibody
Gene SymbolPAGE4
Official Gene Full NameP antigen family, member 4 (prostate associated)
Alias SymbolsPAGE4, GAGEC1, JM27,
NCBI Gene Id9506
Protein NameG antigen family C member 1
Description of TargetThis gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer. It is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. The protein may play a role in benign and malignant prostate diseases. A related pseudogene is located on chromosome 7.
Swissprot IdO60829
Protein Accession #XP_005278137
Protein Size (# AA)102
Molecular Weight11kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express PAGE4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express PAGE4.
Write Your Own Review
You're reviewing:PAGE4 Antibody - N-terminal region (ARP42335_P050)
Your Rating
Aviva Travel Grant
Aviva Pathways
Aviva Blast Tool
Free Microscope