Search Antibody, Protein, and ELISA Kit Solutions

PAGE4 Antibody - N-terminal region (ARP42335_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42335_P050-FITC Conjugated

ARP42335_P050-HRP Conjugated

ARP42335_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PAGE4
Official Gene Full Name:
P antigen family, member 4 (prostate associated)
NCBI Gene Id:
9506
Protein Name:
G antigen family C member 1
Swissprot Id:
O60829
Protein Accession #:
XP_005278137
Alias Symbols:
PAGE4, GAGEC1, JM27,
Description of Target:
This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer. It is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. The protein may play a role in benign and malignant prostate diseases. A related pseudogene is located on chromosome 7.
Protein Size (# AA):
102
Molecular Weight:
11kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAGE4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAGE4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PAGE4
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-PAGE4 (ARP42335_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PAGE4 (ARP42335_P050) antibody is Catalog # AAP42335
Datasheets/Manuals:
Printable datasheet for anti-PAGE4 (ARP42335_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...