- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-PAFAH1B1 (ARP56108_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB, IHC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PAFAH1B1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Peptide Sequence | Synthetic peptide located within the following region: KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-PAFAH1B1 (ARP56108_P050) antibody is Catalog # AAP56108 (Previous Catalog # AAPP38013) |
Subunit | alpha |
Reference | Campo,S., (2008) Aging Clin Exp Res 20 (2), 171-177 |
Gene Symbol | PAFAH1B1 |
---|---|
Gene Full Name | Platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) |
Alias Symbols | MDS, LIS1, LIS2, MDCR, NudF, PAFAH |
NCBI Gene Id | 5048 |
Protein Name | Platelet-activating factor acetylhydrolase IB subunit alpha |
Description of Target | This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 is the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum.PAFAH1B1 was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 encodes the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-378 AC015799.23 48129-48506 c 379-600 AC015799.23 3815-4036 c 601-685 AC005696.1 40697-40781 686-760 AC005696.1 41341-41415 761-967 AC005696.1 42317-42523 968-1136 AC005696.1 45488-45656 1137-1239 AC005696.1 47980-48082 1240-1468 AC005696.1 49385-49613 1469-1570 AC005696.1 51830-51931 1571-1727 AC005696.1 55489-55645 1728-5614 AC005696.1 57054-60940 |
Uniprot ID | P43034 |
Protein Accession # | NP_000421 |
Nucleotide Accession # | NM_000430 |
Protein Size (# AA) | 410 |
Molecular Weight | 47kDa |
Protein Interactions | UBI4; UBC; SUMO2; BICD2; SUMO1; PDIA4; PAPSS1; YWHAH; YWHAG; SNRPF; SNRPD2; PAK2; MYO1E; MSN; HSP90AA4P; HMGB3; FH; EIF5; CAPNS1; CAPN2; ATIC; ASNS; TATDN1; UBXN1; ISOC1; MAPRE1; NDE1; IQCB1; SLC25A10; DCX; NUDCD2; NDEL1; tat; KATNA1; NUDC; KATNB1; CLIP1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PAFAH1B1 Antibody - N-terminal region (ARP56108_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "PAFAH1B1 Antibody - N-terminal region (ARP56108_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "PAFAH1B1 Antibody - N-terminal region (ARP56108_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PAFAH1B1 Antibody - N-terminal region (ARP56108_P050)"?
This target may also be called "MDS, LIS1, LIS2, MDCR, NudF, PAFAH" in publications.
-
What is the shipping cost for "PAFAH1B1 Antibody - N-terminal region (ARP56108_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PAFAH1B1 Antibody - N-terminal region (ARP56108_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PAFAH1B1 Antibody - N-terminal region (ARP56108_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "47kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PAFAH1B1 Antibody - N-terminal region (ARP56108_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PAFAH1B1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PAFAH1B1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PAFAH1B1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PAFAH1B1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PAFAH1B1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PAFAH1B1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.