Search Antibody, Protein, and ELISA Kit Solutions

PAFAH1B1 Antibody - middle region (ARP87411_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PAFAH1B1
Official Gene Full Name:
platelet activating factor acetylhydrolase 1b regulatory subunit 1
NCBI Gene Id:
5048
Protein Name:
Platelet-activating factor acetylhydrolase IB subunit alpha
Swissprot Id:
P43034
Protein Accession #:
NP_000421.1
Nucleotide Accession #:
NM_000430.3
Alias Symbols:
MDS, LIS1, LIS2, MDCR, NudF, PAFAH
Description of Target:
This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. This gene encodes the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum.
Protein Size (# AA):
410
Molecular Weight:
45 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAFAH1B1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAFAH1B1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PAFAH1B1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: TSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PAFAH1B1 (ARP87411_P050) antibody is Catalog # AAP87411
Datasheets/Manuals:
Printable datasheet for anti-PAFAH1B1 (ARP87411_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...