PADI2 Antibody - middle region (ARP52328_P050)

Catalog No: ARP52328_P050

Host: Rabbit
Target Name: PADI2
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: PADI2
Sample Tissue: Human PANC1 Whole Cell
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: PADI2
Sample Type: Hela Whole cell lysates
Antibody Dilution: 1.0ug/ml

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. An isoform contains the peptide sequence at 48 kDa.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PADI2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 83%
• Peptide Sequence: Synthetic peptide located within the following region: RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PADI2 (ARP52328_P050) antibody is Catalog # AAP52328 (Previous Catalog # AAPS31309)
• Enhanced Validation:

  Relative Expression (Western Blot)

Target Info

• Reference: Foulquier,C., (2007) Arthritis Rheum. 56 (11), 3541-3553
• Gene Symbol: PADI2
• Gene Full Name: Peptidyl arginine deiminase, type II
• Alias Symbols: PAD2, PDI2, PAD-H19
• NCBI Gene Id: 11240
• Protein Name: Protein-arginine deiminase type-2
• Description of Target: PADI2 encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. PADI2 is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis.This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9Y2J8
• Protein Accession #: NP_031391
• Nucleotide Accession #: NM_007365
• Protein Size (# AA): 665
• Molecular Weight: 76 kDa
• Protein Interactions: UBC;