PACRG Antibody - middle region (ARP52953_P050)

Catalog No: ARP52953_P050

WB Suggested Anti-PACRG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PACRG
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PACRG (ARP52953_P050) antibody is Catalog # AAP52953 (Previous Catalog # AAPP35007)

Target Info

• Reference: Taylor,J.M., (2007) Neurobiol. Dis. 27 (2), 238-247
• Gene Symbol: PACRG
• Gene Full Name: PARK2 co-regulated
• Alias Symbols: GLUP, PACRG2.1, PARK2CRG, HAK005771
• NCBI Gene Id: 135138
• Protein Name: Parkin coregulated gene protein
• Description of Target: PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death.This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q96M98
• Protein Accession #: NP_689623
• Nucleotide Accession #: NM_152410
• Protein Size (# AA): 296
• Molecular Weight: 33kDa
• Protein Interactions: UBC; TUBB; HOPX; CCT5; CCT8; CCT2; CCT4; CCT7; STUB1; TUBA1A; VCP; CCT3; TCP1; PARK2; HSP90AA1; HSPA4; DNAJA1; GPR37; CCT6A; APP;