Catalog No: ARP57879_P050
Price: $0.00
SKU
ARP57879_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Pa2g4 (ARP57879_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: PDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTVENATSGETLEE
Concentration0.5 mg/ml
Blocking PeptideFor anti-Pa2g4 (ARP57879_P050) antibody is Catalog # AAP57879 (Previous Catalog # AAPP44684)
Gene SymbolPa2g4
Gene Full NameProliferation-associated 2G4
Alias SymbolsP, Ebp, Ebp1, 38kDa, Plfap, AA672939
NCBI Gene Id18813
Protein NameProliferation-associated protein 2G4
Description of TargetPa2g4 may play a role in a ERBB3-regulated signal transduction pathway. It seems be involved in growth regulation. It acts a corepressor of the androgen receptor (AR) and is regulated by the ERBB3 ligand neuregulin-1/heregulin (HRG). It inhibits transcription of some E2F1-regulated promoters, probably by recruiting histone acetylase (HAT) activity. It may be involved in ribosome assembly. It mediates cap-independent translation of specific viral IRESs (internal ribosomal entry site). It together with PTBP1 is required for the translation initiation on the foot-and-mouth disease virus (FMDV) IRES.
Uniprot IDP50580
Protein Accession #NP_035249
Nucleotide Accession #NM_011119
Protein Size (# AA)394
Molecular Weight44kDa
Protein InteractionsPik3r1; STUB1; HSPA4;
  1. What is the species homology for "Pa2g4 Antibody - C-terminal region (ARP57879_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "Pa2g4 Antibody - C-terminal region (ARP57879_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Pa2g4 Antibody - C-terminal region (ARP57879_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Pa2g4 Antibody - C-terminal region (ARP57879_P050)"?

    This target may also be called "P, Ebp, Ebp1, 38kDa, Plfap, AA672939" in publications.

  5. What is the shipping cost for "Pa2g4 Antibody - C-terminal region (ARP57879_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Pa2g4 Antibody - C-terminal region (ARP57879_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Pa2g4 Antibody - C-terminal region (ARP57879_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Pa2g4 Antibody - C-terminal region (ARP57879_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PA2G4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PA2G4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PA2G4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PA2G4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PA2G4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PA2G4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Pa2g4 Antibody - C-terminal region (ARP57879_P050)
Your Rating
We found other products you might like!