Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP47601_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47601_P050-FITC Conjugated

ARP47601_P050-HRP Conjugated

ARP47601_P050-Biotin Conjugated

PA2G4 Antibody - C-terminal region (ARP47601_P050)

Catalog#: ARP47601_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133531 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PA2G4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-PA2G4 (ARP47601_P050)
Peptide Sequence Synthetic peptide located within the following region: LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PA2G4 (ARP47601_P050) antibody is Catalog # AAP47601 (Previous Catalog # AAPP28459)
Datasheets/Manuals Printable datasheet for anti-PA2G4 (ARP47601_P050) antibody
Sample Type Confirmation

PA2G4 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Okada,M., (2007) J. Biol. Chem. 282 (50), 36744-36754
Gene Symbol PA2G4
Official Gene Full Name Proliferation-associated 2G4, 38kDa
Alias Symbols EBP1, HG4-1, p38-2G4
NCBI Gene Id 5036
Protein Name Proliferation-associated protein 2G4
Description of Target PA2G4 is an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells.This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q9UQ80
Protein Accession # NP_006182
Nucleotide Accession # NM_006191
Protein Size (# AA) 394
Molecular Weight 44kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PA2G4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PA2G4.
Protein Interactions DHX9; PKN1; NPM1; NCL; LAMB1; HSPA1B; HNRNPA2B1; ACTB; ERBB3; DDX21; VIM; UBC; RNF20; SUMO2; SUMO3; MDM2; STUB1; HSPA4; YBX1; NMT1; MAP2; KRT17; FAU; RPL23A; RPS27L; EIF3K; DIMT1; NELFB; IGF2BP3; G3BP1; EXOSC5; HMGA2; HMGA1; EEF2K; UBL4A; ITGA4; FN1; IGF2
  1. What is the species homology for "PA2G4 Antibody - C-terminal region (ARP47601_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "PA2G4 Antibody - C-terminal region (ARP47601_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PA2G4 Antibody - C-terminal region (ARP47601_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PA2G4 Antibody - C-terminal region (ARP47601_P050)"?

    This target may also be called "EBP1, HG4-1, p38-2G4" in publications.

  5. What is the shipping cost for "PA2G4 Antibody - C-terminal region (ARP47601_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PA2G4 Antibody - C-terminal region (ARP47601_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PA2G4 Antibody - C-terminal region (ARP47601_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PA2G4 Antibody - C-terminal region (ARP47601_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PA2G4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PA2G4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PA2G4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PA2G4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PA2G4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PA2G4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PA2G4 Antibody - C-terminal region (ARP47601_P050)
Your Rating
We found other products you might like!