Search Antibody, Protein, and ELISA Kit Solutions

PA2G4 Antibody - C-terminal region (ARP47601_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47601_P050-FITC Conjugated

ARP47601_P050-HRP Conjugated

ARP47601_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
PA2G4
Official Gene Full Name:
Proliferation-associated 2G4, 38kDa
NCBI Gene Id:
5036
Protein Name:
Proliferation-associated protein 2G4
Swissprot Id:
Q9UQ80
Protein Accession #:
NP_006182
Nucleotide Accession #:
NM_006191
Alias Symbols:
EBP1, HG4-1, p38-2G4
Replacement Item:
This antibody may replace item sc-133531 from Santa Cruz Biotechnology.
Description of Target:
PA2G4 is an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells.This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
394
Molecular Weight:
44kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PA2G4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PA2G4.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PA2G4
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-PA2G4 (ARP47601_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DHX9; PKN1; NPM1; NCL; LAMB1; HSPA1B; HNRNPA2B1; ACTB; ERBB3; DDX21; VIM; UBC; RNF20; SUMO2; SUMO3; MDM2; STUB1; HSPA4; YBX1; NMT1; MAP2; KRT17; FAU; RPL23A; RPS27L; EIF3K; DIMT1; NELFB; IGF2BP3; G3BP1; EXOSC5; HMGA2; HMGA1; EEF2K; UBL4A; ITGA4; FN1; IGF2
Blocking Peptide:
For anti-PA2G4 (ARP47601_P050) antibody is Catalog # AAP47601 (Previous Catalog # AAPP28459)
Datasheets/Manuals:
Printable datasheet for anti-PA2G4 (ARP47601_P050) antibody
Sample Type Confirmation:

PA2G4 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Okada,M., (2007) J. Biol. Chem. 282 (50), 36744-36754

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...