- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for p90 RSK Antibody (Phospho-Thr359+Ser363) (OAAF07418) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Product Format | LiquidPBS (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol |
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
Additional Information | Modification Sites: Human:T359/S363 Mouse:S352/T348 Rat:S363/T359 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human p90 RSK around the phosphorylation site of Thr359 and Ser363. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: RREIKPPFKPAVAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFS |
Concentration | 1 mg/ml |
Specificity | p90 RSK (Phospho-Thr359+Ser363) Antibody detects endogenous levels of p90 RSK only when phosphorylated at Thr359 and Ser363. |
Application Info | WB: 1:500~1000 IHC: 1:50~100 ELISA: 1:1000 |
Gene Symbol | RPS6KA1 |
---|---|
Gene Full Name | ribosomal protein S6 kinase A1 |
Alias Symbols | 90 kDa ribosomal protein S6 kinase 1;dJ590P13.1 (ribosomal protein S6 kinase, 90kD, polypeptide 1);HU-1;MAP kinase-activated protein kinase 1a;MAPK-activated protein kinase 1a;MAPKAP kinase 1a;MAPKAPK1;MAPKAPK-1a;MAPKAPK1A;p90Rsk;p90-RSK 1;p90RSK1;p90S6K;ribosomal protein S6 kinase alpha-1;ribosomal protein S6 kinase, 90kDa, polypeptide 1;ribosomal S6 kinase 1;RSK;RSK1;RSK-1;S6K-alpha 1. |
NCBI Gene Id | 6195 |
Protein Name | Ribosomal protein S6 kinase alpha-1 |
Description of Target | Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of the transcription factors CREB1, ETV1/ER81 and NR4A1/NUR77, regulates translation through RPS6 and EIF4B phosphorylation, and mediates cellular proliferation, survival, and differentiation by modulating mTOR signaling and repressing pro-apoptotic function of BAD and DAPK1. In fibroblast, is required for EGF-stimulated phosphorylation of CREB1, which results in the subsequent transcriptional activation of several immediate-early genes. In response to mitogenic stimulation (EGF and PMA), phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors and the cofactor CREBBP. Upon insulin-derived signal, acts indirectly on the transcription regulation of several genes by phosphorylating GSK3B at 'Ser-9' and inhibiting its activity. Phosphorylates RPS6 in response to serum or EGF via an mTOR-independent mechanism and promotes translation initiation by facilitating assembly of the pre-initiation complex. In response to insulin, phosphorylates EIF4B, enhancing EIF4B affinity for the EIF3 complex and stimulating cap-dependent translation. Is involved in the mTOR nutrient-sensing pathway by directly phosphorylating TSC2 at 'Ser-1798', which potently inhibits TSC2 ability to suppress mTOR signaling, and mediates phosphorylation of RPTOR, which regulates mTORC1 activity and may promote rapamycin-sensitive signaling independently of the PI3K/AKT pathway. Mediates cell survival by phosphorylating the pro-apoptotic proteins BAD and DAPK1 and suppressing their pro-apoptotic function. Promotes the survival of hepatic stellate cells by phosphorylating CEBPB in response to the hepatotoxin carbon tetrachloride (CCl4). Mediates induction of hepatocyte prolifration by TGFA through phosphorylation of CEBPB (By similarity). Is involved in cell cycle regulation by phosphorylating the CDK inhibitor CDKN1B, which promotes CDKN1B association with 14-3-3 proteins and prevents its translocation to the nucleus and inhibition of G1 progression. Phosphorylates EPHA2 at 'Ser-897', the RPS6KA-EPHA2 signaling pathway controls cell migration (PubMed:26158630). |
Uniprot ID | Q15418 |
Molecular Weight | 82 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "p90 RSK Antibody (Phospho-Thr359+Ser363) (OAAF07418)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "p90 RSK Antibody (Phospho-Thr359+Ser363) (OAAF07418)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "p90 RSK Antibody (Phospho-Thr359+Ser363) (OAAF07418)" provided in?
This item is provided in "LiquidPBS (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol ".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "p90 RSK Antibody (Phospho-Thr359+Ser363) (OAAF07418)"?
This target may also be called "90 kDa ribosomal protein S6 kinase 1;dJ590P13.1 (ribosomal protein S6 kinase, 90kD, polypeptide 1);HU-1;MAP kinase-activated protein kinase 1a;MAPK-activated protein kinase 1a;MAPKAP kinase 1a;MAPKAPK1;MAPKAPK-1a;MAPKAPK1A;p90Rsk;p90-RSK 1;p90RSK1;p90S6K;ribosomal protein S6 kinase alpha-1;ribosomal protein S6 kinase, 90kDa, polypeptide 1;ribosomal S6 kinase 1;RSK;RSK1;RSK-1;S6K-alpha 1." in publications.
-
What is the shipping cost for "p90 RSK Antibody (Phospho-Thr359+Ser363) (OAAF07418)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "p90 RSK Antibody (Phospho-Thr359+Ser363) (OAAF07418)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "p90 RSK Antibody (Phospho-Thr359+Ser363) (OAAF07418)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "82 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "p90 RSK Antibody (Phospho-Thr359+Ser363) (OAAF07418)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RPS6KA1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RPS6KA1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RPS6KA1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RPS6KA1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RPS6KA1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RPS6KA1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.