OVOL1 Antibody - C-terminal region : FITC (ARP38500_T100-FITC)

Catalog No: ARP38500_T100-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human OVOL1
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: QKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-OVOL1 (ARP38500_T100-FITC) antibody is Catalog # AAP38500 (Previous Catalog # AAPS04310)
• Reference: Dai,X., (1998) Genes Dev. 12 (21), 3452-3463

Target Info

• Gene Symbol: OVOL1
• Gene Full Name: Ovo-like 1(Drosophila)
• Alias Symbols: HOVO1
• NCBI Gene Id: 5017
• Protein Name: Putative transcription factor Ovo-like 1
• Description of Target: OVOL1 is a protein highly similar to Drosophila and mouse proteins. In Drosophila the ovo protein plays a critical role in Drosophila oogenesis and cuticle formation. In mice the ovo like protein is involved in hair formation and spermatogenesis. The function of the human gene product has not been determined.This gene encodes a protein highly similar to Drosophila and mouse proteins. In Drosophila the ovo protein plays a critical role in Drosophila oogenesis and cuticle formation. In mice the ovo like protein is involved in hair formation and spermatogenesis. The function of the human gene product has not been determined.
• Uniprot ID: O14753
• Protein Accession #: NP_004552
• Nucleotide Accession #: NM_004561
• Protein Size (# AA): 267
• Molecular Weight: 30kDa
• Protein Interactions: MAFF; HDAC3; HDAC2; HDAC1;