Catalog No: ARP57000_P050-Biotin
Price: $434.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

OTUB1 Antibody - middle region : Biotin (ARP57000_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-OTUB1 (ARP57000_P050-Biotin) antibody
Product Info
ReferenceJuris,S.J., (2006) FEBS Lett. 580 (1), 179-183
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human OTUB1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK
Concentration0.5 mg/ml
Blocking PeptideFor anti-OTUB1 (ARP57000_P050-Biotin) antibody is Catalog # AAP57000 (Previous Catalog # AAPP39943)
Sample Type Confirmation

OTUB1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, HepG2

Gene SymbolOTUB1
Gene Full NameOTU domain, ubiquitin aldehyde binding 1
Alias SymbolsOTB1, OTU1, HSPC263
NCBI Gene Id55611
Protein NameUbiquitin thioesterase OTUB1
Description of TargetThe product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin
Uniprot IDQ96FW1
Protein Accession #NP_060140
Nucleotide Accession #NM_017670
Protein Size (# AA)271
Molecular Weight31kDa
  1. What is the species homology for "OTUB1 Antibody - middle region : Biotin (ARP57000_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "OTUB1 Antibody - middle region : Biotin (ARP57000_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "OTUB1 Antibody - middle region : Biotin (ARP57000_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "OTUB1 Antibody - middle region : Biotin (ARP57000_P050-Biotin)"?

    This target may also be called "OTB1, OTU1, HSPC263" in publications.

  5. What is the shipping cost for "OTUB1 Antibody - middle region : Biotin (ARP57000_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "OTUB1 Antibody - middle region : Biotin (ARP57000_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "OTUB1 Antibody - middle region : Biotin (ARP57000_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "31kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "OTUB1 Antibody - middle region : Biotin (ARP57000_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "OTUB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "OTUB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "OTUB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "OTUB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "OTUB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "OTUB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:OTUB1 Antibody - middle region : Biotin (ARP57000_P050-Biotin)
Your Rating
We found other products you might like!