OSM34 Recombinant Protein (Mouse-ear cress) (OPCA04559)

Catalog No: OPCA04559

Product Info

• Predicted Species Reactivity: Arabidopsis thaliana
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Arabidopsis thaliana (Mouse-ear cress)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN
• Protein Sequence: ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 23-244 aa
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• Reference: Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G., Pohl T., Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N., Harris B., Ansorge W., Brandt P., Grivell L.A., Rieger M., Weichselgartner M., de Simone V., Obermaier B. McCombie W.R.Nature 402:769-777(1999)

Target Info

• Gene Symbol: OSM34
• Gene Full Name: osmotin 34
• Alias Symbols: AT4G11650;ATOSM34;osmotin 34;T5C23.80;T5C23_80.
• NCBI Gene Id: 826770
• Protein Name: Osmotin-like protein OSM34
• Uniprot ID: P50700
• Protein Size (# AA): Recombinant
• Molecular Weight: 44.4 kDa