SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63083_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-OSCAR (ARP63083_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: LSQRSEVLVISWEDSGSSDYTRGNLVRLGLAGLVLISLGALVTFDWRSQN
Concentration0.5 mg/ml
Blocking PeptideFor anti-OSCAR (ARP63083_P050) antibody is Catalog # AAP63083
Gene SymbolOSCAR
Gene Full NameOsteoclast associated, immunoglobulin-like receptor
Alias SymbolsPIGR3, PIgR-3
NCBI Gene Id126014
Protein NameOsteoclast-associated immunoglobulin-like receptor
Description of TargetOsteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex (LRC) protein family that plays critical roles in the regulation of both innate and adaptive immune responses. Different from the other LRC members, OSCAR expression is detected specifically in preosteoclasts or mature osteoclasts. OSCAR may be an important bone-specific regulator of osteoclast differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ8IYS5-6
Protein Accession #NP_573398
Nucleotide Accession #NM_133168
Protein Size (# AA)252
Molecular Weight27kDa
Protein InteractionsFCAR;
  1. What is the species homology for "OSCAR Antibody - C-terminal region (ARP63083_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "OSCAR Antibody - C-terminal region (ARP63083_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "OSCAR Antibody - C-terminal region (ARP63083_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "OSCAR Antibody - C-terminal region (ARP63083_P050)"?

    This target may also be called "PIGR3, PIgR-3" in publications.

  5. What is the shipping cost for "OSCAR Antibody - C-terminal region (ARP63083_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "OSCAR Antibody - C-terminal region (ARP63083_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "OSCAR Antibody - C-terminal region (ARP63083_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "OSCAR Antibody - C-terminal region (ARP63083_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "OSCAR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "OSCAR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "OSCAR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "OSCAR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "OSCAR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "OSCAR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:OSCAR Antibody - C-terminal region (ARP63083_P050)
Your Rating
We found other products you might like!