ORF3 Recombinant Protein (PLrV) (OPCA04260)

Catalog No: OPCA04260

Product Info

• Predicted Species Reactivity: Potato Leafroll Virus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Potato leafroll virus (strain Potato/Canada/Rowhani/1979) (PLrV)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK
• Protein Sequence: MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-208 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Identification and characterization of the potato leafroll virus putative coat protein gene.Kawchuk L.M., Martin R.R., Rochon D.M., McPherson J.J. Gen. Virol. 70:783-788(1989)
• Gene Symbol: ORF3
• Alias Symbols: Coat protein.
• Protein Name: Major capsid protein
• Description of Target: Major capsid protein.
• Uniprot ID: P17521
• Protein Size (# AA): Recombinant
• Molecular Weight: 27.2 kDa