SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP57782_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP57782_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ORC4L Antibody - middle region : FITC (ARP57782_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ORC4 (ARP57782_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ORC4L
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV
Concentration0.5 mg/ml
Blocking PeptideFor anti-ORC4 (ARP57782_P050-FITC) antibody is Catalog # AAP57782 (Previous Catalog # AAPP38839)
Subunit4
ReferenceClarke,C.A. Biochem. J. 388 (PT 2), 705-712 (2005)
Gene SymbolORC4
Gene Full NameOrigin recognition complex, subunit 4
Alias SymbolsORC4L, ORC4P
NCBI Gene Id5000
Protein NameOrigin recognition complex subunit 4
Description of TargetThe origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves
Uniprot IDO43929
Protein Accession #NP_859525
Nucleotide Accession #NM_181741
Protein Size (# AA)436
Molecular Weight50kDa
Protein InteractionsRRM2B; TCF4; MCM3; MTUS1; MCM10; FBXL8; FBXO6; FBXO25; FBXL5; ORC3; ORC6; UBC; ORC5; ORC2; MLH1; MCM7; KPNA1; CTBP1; CDKN2A; CCND1; APP; XRCC5; XRCC6; CCL2; tat; MCM2; ORC1; MCM6; MCM4; DBF4; RPA2;
  1. What is the species homology for "ORC4L Antibody - middle region : FITC (ARP57782_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ORC4L Antibody - middle region : FITC (ARP57782_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ORC4L Antibody - middle region : FITC (ARP57782_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ORC4L Antibody - middle region : FITC (ARP57782_P050-FITC)"?

    This target may also be called "ORC4L, ORC4P" in publications.

  5. What is the shipping cost for "ORC4L Antibody - middle region : FITC (ARP57782_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ORC4L Antibody - middle region : FITC (ARP57782_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ORC4L Antibody - middle region : FITC (ARP57782_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ORC4L Antibody - middle region : FITC (ARP57782_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ORC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ORC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ORC4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ORC4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ORC4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ORC4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ORC4L Antibody - middle region : FITC (ARP57782_P050-FITC)
Your Rating
We found other products you might like!